Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in active transport of inorganic phosphate across the membrane (import). This is one of the proteins required for binding-protein-mediated phosphate transport.
ProductPeriplasmic phosphate-binding lipoprotein PstS2 (PBP-2) (PstS2)
CommentsRv0932c, (MTCY08D9.07), len: 370 aa. PstS2, phosphate-binding lipoprotein component of inorganic phosphate transport system (see citations below), highly similar to AAF74819.1|AF137360_1|AF137360 periplasmic phosphate permease from Mycobacterium avium (369 aa); Rv0928|MTCY21C12.22|pstS3 phosphate-binding periplasmic lipoprotein from Mycobacterium tuberculosis (370 aa), FASTA scores: opt: 1601, E(): 0, (64.5% identity in 372 aa overlap); and Rv0934|MTCY08D9.05c|pstS1 phosphate-binding periplasmic lipoprotein from Mycobacterium tuberculosis (374 aa) (Mycobacterium tuberculosis seems to have three PstS-like proteins, others being Rv0928 and Rv0934c). Also highly similar to MTCY08D9.05c|P15712|PAB_MYCTU protein antigen B precursor from Mycobacterium tuberculosis (374 aa), FASTA scores: opt: 460, E(): 2.7e-20, (31.2% identity in 375 aa overlap). Contains prokaryotic membrane lipoprotein lipid attachment site (PS00013) at N-terminus so the leader peptide of 22 aa is probably removed. Belongs to family of phosphate receptors for bacterial ABC-type lipoprotein transporters. Appears to be co-transcribed with Rv0931c|pknD|mbk.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Predicted surface lipoprotein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified in the culture filtrate of M. tuberculosis H37Rv using LC-MS/MS; antigen recognized by serum pool from tuberculosis patients (See Malen et al., 2008). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10399361041048-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0932c|pstS2
VKFARSGAAVSLLAAGTLVLTACGGGTNSSSSGAGGTSGSVHCGGKKELHSSGSTAQENAMEQFVYAYVRSCPGYTLDYNANGSGAGVTQFLNNETDFAGSDVPLNPSTGQPDRSAERCGSPAWDLPTVFGPIAITYNIKGVSTLNLDGPTTAKIFNGTITVWNDPQIQALNSGTDLPPTPISVIFRSDKSGTSDNFQKYLDGASNGAWGKGASETFNGGVGVGASGNNGTSALLQTTDGSITYNEWSFAVGKQLNMAQIITSAGPDPVAITTESVGKTIAGAKIMGQGNDLVLDTSSFYRPTQPGSYPIVLATYEIVCSKYPDATTGTAVRAFMQAAIGPGQEGLDQYGSIPLPKSFQAKLAAAVNAIS
      
Bibliography