Gene Rv0940c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible oxidoreductase |
| Comments | Rv0940c, (MTCY10D7.34), len: 288 aa. Possible oxidoreductase, similar to hypothetical proteins and oxidoreductases e.g. AAK38097.1|AF323606_3|AF323606 putative F420-dependent dehydrogenase from Rhodococcus erythropolis (295 aa); AAG52987.1|AF040570|Rif17 putative alkanal monooxygenase from Amycolatopsis mediterranei (356 aa); etc. Also similar to putative oxidoreductases from Mycobacterium tuberculosis such as Rv0953c|P71557|YT21_MYCTU (282 aa), FASTA scores: opt: 311, E(): 3.7e-08, (31.0% identity in 248 aa overlap), Rv3079c (275 aa), Rv0791c (347 aa), etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1050593 | 1051459 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0940c|Rv0940c
VRFSYAEAMTDFTFYIPLAKAAEAAGYSSMTIPDSIAYPFESDSKYPYTPDGNREFMDGKPFIETFVLTAALGAVTTRLRFNFFVLKLPIRPPALVAKQAGSLAALIGNRVGLGVGTSPWPEDYELMGVPFAKRGKRIDECIEIVRGLTTGDYFEFHGEFYDIPKTKMTPAPTQPIPILVGGHADAALRRAARADGWMHGGGDPDELDRLIARVKRLREEAGKTSPFEIHVISLDGFTVDGVKRLEDKGVTDVIVGFRVPYTMGPDTEPLQTKIRNLEMFAENVIAKV
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
