Gene Rv1002c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved membrane protein |
| Comments | Rv1002c, (MTCI237.17c), len: 503 aa. Conserved membrane protein. Predicted to be in the GT-C superfamily of glycosyltransferases (See Liu and Mushegian, 2003). Similar to AL132674|SCE87.05 hypothetical protein from Streptomyces coelicolor (591 aa), FASTA scores: opt: 666, E(): 0, (39.0% identity in 546 aa overlap); weakly similar and to TSCC_PSEAM|P55019 thiazide-sensitive sodium-chloride cotransporter from Pseudopleuronectes americanus (1023 aa), FASTA scores: opt: 44, E(): 4.2e-06, (22.4% identity in 326 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1118428 | 1119939 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1002c|Rv1002c
VVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFLNLGSLTDAGTPIFDEKHYAPQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGYNGFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAGVLLICDGVSFVTARTALLDGFLTFFVVAAFGALIVDRDQVRERMHIALLAGRSAATVWGPRVGVRWWRFGAGVLLGLACATKWSGVYFVLFFGAMALAFDVAARRQYQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATYAPWFASETAIDRHAVGQAVGRNSVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPWTWPMSLRPVLYAIDQQDVAGCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDWRYAVVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLVMGISLVLGDILYHPGQGSERRTLGLIVVCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR
Bibliography
- Liu J et al. [2003]. Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Homology
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
