Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1043c, (MTCY10G2.06), len: 341 aa. Conserved hypothetical protein similar to AL096872|SC5F7.08 putative lipoate-protein ligase from Streptomyces coelicolor (362 aa), FASTA scores: opt: 206, E(): 1.4e-05, (30.3% identity in 201 aa overlap). Weak similarity to P39668|YYXA_BACSU hypothetical protease from Bacillus subtitis (400 aa), FASTA scores: opt: 159, E(): 0.013, (27.1% identity in 210 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11657811166806-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1043c|Rv1043c
MCAHQFFGLVHNPVVAAAIGKPEPPPVDSDIGLPTTVPFEPWSVADFSRYLSTLGLPAAGDAVTLHRILSSMERAGLLLPLGWDPRLPVMGQKYISQGAISKGQRGGNLWLSEVFGAELIIPSYNAVTVQLAGHDDAGNPVDSWGTGLVVDHNHVITNKHVVTGLAGTSAGLSVYPSSNHAEAELVNFSGTAHPHPTLDVAVIKFEMPEGKYIPRLGGMAFRDPDWADEVYVFGYPRVPMTAEMAITVQRGEVVNPAATTIPGRQKIFLYSAIARPGNSGGPIVAQDGRVIGLVVEDSAEAPSTGTGPNAAPFYRGIPSSEVIRALDELDFGGIVEMDTLP