Gene Rv1059
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved protein |
Comments | Rv1059, (MTV017.12), len: 354 aa. Conserved protein, similar to Rv0926c|MTCY21C12.20c hypothetical protein from Mycobacterium tuberculosis (358 aa), FASTA scores: opt: 338, E(): 1.4e-14, (33.1% identity in 363 aa overlap). |
Functional category | Conserved hypotheticals |
Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1182391 | 1183455 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1059|Rv1059 VTMSLRVIQWATGSVGVAAIKGVLQHPELELVGCWVHSAAKSGKDVGEIIGSPPLGVIATNSIDDVLALDADAVIYAPLLPSVDEVAALLRSGKNVVTPLGWFYPSEKEAAPLEVAAQAGNATLHGAGIGPGAVTELFPLLLSVMSTGVTFVRSEEFSDLRSYGAPDVLRYVMGFGGTPDSALTGPMQKILDGGFLQSVRLCVDRLGFAADPQIRTSQEVAVATAPIDSPIGVIEPGQVAGRRFHWEALVEDTVVVQIAVNWLMGSENLDPPWSFGPAGERYEIEVRGSPDTCVTIKGWQPQTVAAGLKSNPGIVATAAHCVNAIPATCAAPAGIQSFFDLPLITGRAAPGLAR
Bibliography
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant