Gene Rv1063c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1063c, (MTV017.16c), len: 360 aa. Conserved hypothetical protein, similar to P37053|YCHK_ECOLI hypothetical protein from Escherichia coli (314 aa), FASTA scores: opt: 487, E(): 7.2e-23, (32.7% identity in 321 aa overlap). Also partially similar to Rv3239c|MTCY20B11.14c. Belongs to the UPF0028 (SWS) family. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1185741 | 1186823 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1063c|Rv1063c
MPAPAALRVRGSSSPRVALALGSGGARGYAHIGVIQALRERGYDIVGIAGSSMGAVVGGVHAAGRLDEFAHWAKSLTQRTILRLLDPSISAAGILRAEKILDAVRDIVGPVAIEQLPIPYTAVATDLLAGKSVWFQRGPLDAAIRASIAIPGVIAPHEVDGRLLADGGILDPLPMAPIAGVNADLTIAVSLNGSEAGPARDAEPNVTAEWLNRMVRSTSALFDVSAARSLLDRPTARAVLSRFGAAAAESDSWSQAPEIEQRPAGPPADREEAADTPGLPKMGSFEVMNRTIDIAQSALARHTLAGYPADLLIEVPRSTCRSLEFHRAVEVIAVGRALATQALEAFEIDDDESAAATIEG
Bibliography
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
