Gene Rv1115
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible exported protein |
| Comments | Rv1115, (MTCY22G8.04), len: 232 aa. Possible exported protein, contains possible N-terminal signal sequence. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain and no virulence modification seen in SCID mice (see McAdam et al., 2002). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1240187 | 1240885 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1115|Rv1115
VISTTRIDFLWILSVAFASMIALATLLTLINQVVGTPYIPGGDSPAGTDCSELASWVSNAATARPVFGDRFNTGNEEAALAARGFQQGTAPNALVIGWNGHHTAVTLPDGTPVSSGEGGGVRVGGGGAYQPKFTHHMYLPMDVDAGEDQPPAPDEPVTAVDDVEPEMPAPCPTQRPPVTPRHNLCNKLRTMPGALSAALAAAAPVWPAPISGCRGFSTSLLAKRNHPVIVGK
Bibliography
- McAdam RA, Quan S, Smith DA, Bardarov S, Betts JC, Cook FC, Hooker EU, Lewis AP, Woollard P, Everett MJ, Lukey PT, Bancroft GJ, Jacobs Jr WR and Duncan K [2002]. Characterization of a Mycobacterium tuberculosis H37Rv transposon library reveals insertions in 351 ORFs and mutants with altered virulence. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
