Gene Rv1123c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Supposedly involved in detoxification reactions. |
| Product | Possible peroxidase BpoB (non-haem peroxidase) |
| Comments | Rv1123c, (MTCY22G8.12c), len: 302 aa. Possible bpoB, peroxidase (non-haem peroxidase), with some similarity to a range of enzymes from several organisms including: DEH1_MORSP|Q01398 haloacetate dehalogenase from Moraxella sp. (294 aa), FASTA scores: opt: 201, E(): 2.1e-06, (35.8% identity in 134 aa overlap); and BPA1_STRAU|P33912 non-haem bromoperoxidase bpo-a1 from Streptomyces aureofaciens (274 aa), FASTA scores: opt: 187, E(): 1.6e-05, (23.1% identity in 281 aa overlap). Similar to several other Mycobacterium tuberculosis proteins, probable epoxide hydrolases and non-heme bromoperoxidases e.g. Rv1938, Rv3617, Rv3473c, Rv3171c, etc. Contains PS00216 Sugar transport proteins signature 1. |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1246144 | 1247052 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1123c|bpoB
MTIWRVPSKVTSGPVSAVSSSPQAVAFSGARGITLVADEWNRGAAAADRPTILMLHGGGQNRFSWKNTGQILADEGHHVVALDTRGPGDSDRAPGADYAVETPTTDVLHVVEAIGRRVVVVEASMGGLTGILVAERAGPQTVNGLVLVDVVPRYEKEGNARIRDFMLGNIDGFGSLEEAADAVAEYLPHRDKPRSPEGLKRNLRLRDGRWHWHWDPAMMTAPGHDPQLRTENFERAAMGLTIPVLLIRGKLSDVVSSDGARDFLAKVPNAEFVELSNAGRTAAGDDNDAFTDVVVDFVRRLS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant