Gene Rv1125
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1125, (MTCY22G8.14), len: 414 aa. Conserved hypothetical protein. Similar to AL133278|SCM11.13 hypothetical protein from Streptomyces coelicolor (446 aa), FASTA scores: opt: 182, E(): 0.0005, (28.1% identity in 437 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1248082 | 1249326 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1125|Rv1125
VAGHRMAAVDAQFYWMSAKVPNDQFLLYAFDGEPTDLERAVAQVYRRARGCPGLGMRVQDRGALAYPQWVPTPVQRDQLVCHDLADRSWQGCLAAVVGLASKQLDMRRMPWRLHVFTPVHDVPGVSGLGTVAVMQFAHALGDGARASAMAAWLFGRPAAVPEIARSRAGFLPWRAAHAARAHLRLVRDTNAGLVAPGVGSRPPLSTNARPEGVRAVRTLLRRRSQLAGPTVTVTVLAAVSTGLLGLLGGDVDTLGAEVPMAKPGVPRSYNHFGNVVVGLYPRLEPDERVRRIATDLANARRRFEHPAMLSADRAFAAVPAALLRWGVSQFDAEVRPVRVAGNTVVSSVYRGAADLSFGDAPVVLTAGYPALSPAMGLTHGVHGIGDTVAISVHAAESAVSDIDAYMRLLDAALQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
