Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1125, (MTCY22G8.14), len: 414 aa. Conserved hypothetical protein. Similar to AL133278|SCM11.13 hypothetical protein from Streptomyces coelicolor (446 aa), FASTA scores: opt: 182, E(): 0.0005, (28.1% identity in 437 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS12480821249326+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1125|Rv1125
VAGHRMAAVDAQFYWMSAKVPNDQFLLYAFDGEPTDLERAVAQVYRRARGCPGLGMRVQDRGALAYPQWVPTPVQRDQLVCHDLADRSWQGCLAAVVGLASKQLDMRRMPWRLHVFTPVHDVPGVSGLGTVAVMQFAHALGDGARASAMAAWLFGRPAAVPEIARSRAGFLPWRAAHAARAHLRLVRDTNAGLVAPGVGSRPPLSTNARPEGVRAVRTLLRRRSQLAGPTVTVTVLAAVSTGLLGLLGGDVDTLGAEVPMAKPGVPRSYNHFGNVVVGLYPRLEPDERVRRIATDLANARRRFEHPAMLSADRAFAAVPAALLRWGVSQFDAEVRPVRVAGNTVVSSVYRGAADLSFGDAPVVLTAGYPALSPAMGLTHGVHGIGDTVAISVHAAESAVSDIDAYMRLLDAALQ