Gene Rv1136
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in carnitine metabolism. |
| Product | Possible enoyl-CoA hydratase |
| Comments | Rv1136, (MTCI65.03), len: 113 aa. Probable enoyl-CoA hydratase (possible gene fragment). Some similarity to N-terminus of carnitine racemases and enoyl-CoA hydratases (but much shorter) e.g. I41014 carnitine racemase from Escherichia coli (297 aa), FASTA scores: opt: 258, E(): 2.5e-11, (44.5% identity in 110 aa overlap); and Rv0222 putative enoyl-CoA hydratase from M. tuberculosis (262 aa). |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1264606 | 1264947 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1136|Rv1136
MVITINRPEARNAVNGAVSIVVGDALEEAHDNPDVRAVVITGAGDKSLCAGADLKAIARRENPYHPHHGEWGIAGYRHHFIDKPTSAAVSGTALDDGAEPALASDLVVADEHT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
