Gene Rv1163
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Nitrate reduction [catalytic activity: nitrite + acceptor = nitrate + reduced acceptor]. |
| Product | Probable respiratory nitrate reductase (delta chain) NarJ |
| Comments | Rv1163, (MTCI65.30), len: 201 aa. Probable narJ, respiratory nitrate reductase delta chain. Similar to others e.g. P42178|NARJ_BACSU nitrate reductase delta chain from Bacillus subtilis (184 aa), FASTA scores: opt: 254, E(): 1.9e-10, (31.8% identity in 179 aa overlap); etc. Strong similarity to region from aa 260 - 410 of Rv1736c|MTCY04C12.21c|NARX probable nitrate reductase from Mycobacterium tuberculosis (64.8% identity in 159 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1292798 | 1293403 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1163|narJ
VWQSASLLLAYPDDGLAERLHMVDALRAHQTGPAAALLGRTVAELRALAPMAAAAQYVETFDMRRRSTMYLTYWTAGDTRNRGREMLAFATAYRDAGVKPPRTEAPDYLPVVLEFAATVDPEAGRRLLTEHRVPIDVLRGALADAKSPYEYTVAAICETLPAATNQEVRRAQRLAQSGPPAEAVGLQPFTLTVPPKRAEGA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Stermann M et al. [2003]. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. Mutant Function Secondary
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
