Gene Rv1164
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Nitrate reduction [catalytic activity: nitrite + acceptor = nitrate + reduced acceptor]. |
| Product | Probable respiratory nitrate reductase (gamma chain) NarI |
| Comments | Rv1164, (MTCI65.31), len: 246 aa. Probable narI, respiratory nitrate reductase gamma chain. Similar to others e.g. NARI_BACSU|P42177 nitrate reductase gamma chain from Bacillus subtilis (223 aa), FASTA scores: opt: 652, E(): 0; (41.6% identity in 221 aa overlap); etc. Highly similar to C-terminal part of Rv1736c|MTCY04C12.21c|NARX probable nitrate reductase (gamma chain) from Mycobacterium tuberculosis (68.6% identity in 239 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1293406 | 1294146 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1164|narI
LAVLDLVEIFWDAAPYVVVAIAVVGTWWRYRYDKFGWTTRSSQLYESRLLSIGSPMFHFGSLLVIMGHVMGLFIPDSWTRAFGMSDHLYHLQALLLGAPAGFATLLGIGLLIYRRRIQTPVWLATTRNDKLMYLVLVCAIVAGLACTLMGATHEGDMHDYRRSVSVWFRSIWMLAPRGDLMAQATLYYQVHVLIALALFALWPFTRLVHAFSAPIAYLFRPYIVYRSREVAAKHELIGSAPRRRGW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Stermann M et al. [2003]. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. Mutant Function Secondary
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant