Gene Rv1177
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| Product | Probable ferredoxin FdxC |
| Comments | Rv1177, (MTV005.13), len: 108 aa. Probable fdxC, ferredoxin, equivalent to NP_302047.1|NC_002677 ferredoxin from Mycobacterium leprae (108 aa); P00215|FER_MYCSM ferredoxin from Mycobacterium smegmatis (106 aa), FASTA scores: opt: 705, E(): 0, (87.7% identity in 106 aa overlap). Also highly similar to many e.g. JH0239 ferredoxin precursor from Saccharopolyspora erythraea (105 aa); P24496|FER_SACER ferredoxin from Saccharopolyspora erythraea (106 aa); etc. Contains PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature. Belongs to the bacterial type ferredoxin family. Cofactor: binds 1 4FE-4S cluster and a 3FE-4S cluster (by similarity). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1309005 | 1309331 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1177|fdxC
VTYTIAEPCVDIKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVCPVEAIFYEDDVPEQWSHYTQINADFFAELGSPGGAAKVGMTENDPQAVKDLAPQSEDA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Ricagno S et al. [2007]. The crystal structure of FdxA, a 7Fe ferredoxin from Mycobacterium smegmatis. Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
