Gene Rv1191
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv1191, (MTCI364.03), len: 304 aa. Conserved protein, similar to Q54528 RDMC from Streptomyces purpurascens (298 aa), FASTA scores: opt: 196, E(): 1.5e-05, (27.5% identity in 269 aa overlap); Rv0134|MTCI5.08 (300 aa), FASTA scores: opt: 197, E(): 6.6e-06, (26.4% identity in 299 aa overlap), some similarity to PIP_NEIGO|P42786 proline iminopeptidase (310 aa), FASTA scores: opt: 196, E(): 1.3e-05, (32.2% identity in 152 aa overlap). Contains PS00044 Bacterial regulatory proteins, lysR family signature. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Detected by 2-DE and MS in M. tuberculosis H37Rv purified from phagosomes of infected murine bone marrow macrophages but not in H37Rv broth-cultures (See Mattow et al., 2006). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1333931 | 1334845 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1191|Rv1191
MAVAIARPKLEGNIAVGEDRRIGFAEFGAPQGRAVFWLHGTPGARRQIPTEARVYAEHHNIRLIGVDRPGIGASTPHQYETILAFADDLRTIADTLGIDKMAVVGLSGGGPYTLACAAGLPDRVVAAGVLGGVAPTRGPDAISGGLMRLGSAVAPLLQVGGTPLRLGASLLIRAARPVASPALDLYGLLSPRADRHLLARPEFKAMFLDDLLNGSRKQLAAPFADVIAFARDWGFRLDEVKVPVRWWHGDHDHIVPFSHGEHVVSRLPDAKLLHLPGESHLAGLGRGEEILSTLMQIWDRDLRK
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Mattow J, Siejak F, Hagens K, Becher D, Albrecht D, Krah A, Schmidt F, Jungblut PR, Kaufmann SH and Schaible UE [2006]. Proteins unique to intraphagosomally grown Mycobacterium tuberculosis. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant