Gene Rv1217c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of tetronasin across the membrane (export): tetronasin resistance by an export mechanism. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable tetronasin-transport integral membrane protein ABC transporter |
| Comments | Rv1217c, (MTCI364.29c), len: 548 aa. Probable tetronasin-transport integral membrane ABC transporter (see citation below), similar to many e.g. AL049754|SCH10_12 probable ABC-type transport system membrane-spanning protein from Streptomyces coelicolor (539 aa), FASTA scores: opt: 1309, E(): 0, (40.9% identity in 550 aa overlap); Q54407|X73633 TnrB3 protein from Streptomyces longisporoflavus (337 aa), FASTA scores: opt: 692, E(): 0, (39.5% identity in 324 aa overlap); etc. Also has regions similar to Mycobacterium leprae proteins Q49964|U1756Q (109 aa), FASTA scores: opt: 431, E(): 3.1e-20, (64.8% identity in 105 aa overlap) and Q49965|U1756R (82 aa), FASTA scores: opt:154, E(): 0.0028, (61.0% identity in 41 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1360155 | 1361801 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1217c|Rv1217c
VSSTVIDRARPAGHRAPHRGSGFTGTLGLLRLYLRRDRVSLPLWVLLLSVPLATVYIASVETVYPDRSARAAAAAAIMASPAQRALYGPVYNDSLGAVGIWKAGMFHTLIAVAVILTVIRHTRADEESGRAELIDSTVVGRYANLTGALLLSFGASIATGAIGALGLLATDVAPAGSVAFGVALAASGMVFTAVAAVAAQLSPSARFTRAVAFAVLGTAFALRAIGDAGSGTLSWCSPLGWSLQVRPYAGERWWVLLLSLATAAVLTVLAYRLRAGRDVGAGLIAERPGAGTAGPMLSEPFGLAWRLNRGSLLLWTVGLCLYGLVMGSVVHGIGDQLGDNTAVRDIVTRMGGTGALEQAFLALAFTMIGMVAAAFAVSLTLRLHQEETGLRAETLLAGAVSRTHWLASHLAMALAGSAVATLISGVAAGLAYGMTVGDVGGKLPTVVGTAAVQLPAVWLLSAVTVGLFGLAPRFTPVAWGVLVGFIALYLLGSLAGFPQMLLNLEPFAHIPRVGGGDFTAVPLLWLLAIDAALITLGAMAFRRRDVRC
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
