Gene Rv1232c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv1232c, (MTV006.04c), len: 435 aa. Conserved protein, similar to other hypothetical proteins e.g. AB013374|AB013374_2 Bacillus halodurans C-125 mamX (449 aa), FASTA scores: opt: 381, E(): 1e-16, (29.9% identity in 251 aa overlap). Some similarity in N-terminus to U15180|MLU1518033 hypothetical Mycobacterium leprae protein u1756u (329 aa), FASTA scores: opt: 300, E(): 4.1e-12, (69.3% identity in 75 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1374861 | 1376168 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1232c|Rv1232c
MGSVNRVYLARLSRMSVLGPLGESFGRVRDVVISISIVRQQPRVLGLVVDLATRRKIFIPILRVAAIEPHAVTLSTGNVSLHRFEQRPGEALALGQVLDTLVKVNDPALPELAGVDVVVTDLGVEQTRSRDWMVTRVAVRTQRRLRRRCPVHVVDWHNVAGLTPSALAMPGQDVAQLLDQFEGWKAVDVADAIRGLPPKRRHEVFKALHDKRLADVLQELPELDQAEVLSQLGTERAADVLEEMDPDDAADLLAVLNPTEAELLLTRMDPGDSGQVRRLLTHSPDTAGGLMTSDPVVLTPDTSIAEALARVRDPDLTPALASMVFVARPPTATPTGHYLGCVHLQRLLRDPPAELVGGVVDTDLLTLTPETPLAAVTRYFAAYNLVCGPVVDDENHLLGAVTVDDLLDHLLPHDWRVDMPELDPSGAPDRPGGPR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
