Gene Rv1239c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in transport of magnesium and cobalt ions across the membrane. Responsible for the translocation of the substrate across the membrane. |
| Product | Possible magnesium and cobalt transport transmembrane protein CorA |
| Comments | Rv1239c, (MTV006.11c), len: 366 aa. Possible corA, magnesium and cobalt transport transmembrane protein, highly similar to U15180 corA protein from Mycobacterium leprae (373 aa), FASTA scores: opt: 1985, E(): 0, (79.1% identity in 369 aa overlap). Also similar to various CorA proteins of Gram negative bacteria e.g. P27841|CORA_ECOLI|B3816|Z5333|ECS4746 Magnesium and cobalt transport protein from Escherichia coli strains K12 and O157:H7 (316 aa), FASTA scores: opt: 236, E(): 8e-08, (24.5% identity in 306 aa overlap); etc. Seems to belong to the MIT family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1381942 | 1383042 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1239c|corA
VFPGFDALPEVLRPVARPQPPNAHPVAQPPAQALVDCGVYVCGQRLPGKYTYAAALREVREIELTGQEAFVWIGLHEPDENQMQDVADVFGLHPLAVEDAVHAHQRPKLERYDETLFLVLKTVNYVPHESVVLAREIVKTGEIMIFVGKDFVVTVRHGEHGGLSEVRKRMDADPEHLRLGPYAVMHAIADYVVDHYLEVTNLMETDIDSIEEVAFAPGRKLDIEPIYLLKREVVELRRCVNPLSTAFQRMQTESKDLISKEVRRYLRDVADHQTEAADQIASYDDMLNSLVQAALARVGMQQNMDMRKISAWAGIIAVPTMIAGIYGMNFHFMPELDSRWGYPTVIGGMVLICLFLYHVFRNRNWL
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
