Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyzes the acylation of the mycaminose sugar during midecamycin biosynthesis
ProductProbable acyltransferase
CommentsRv1254, (MTCY50.28c), len: 383 aa. Probable Acyltransferase, similar to G927228 midecamycin 4-0-propionyl transferase (fragment) (388 aa), FASTA scores, opt: 305, E(): 5.6e-14, (28.4% identity in 377 aa overlap). Also similar to other Mycobacterium tuberculosis acyltransferases e.g. Rv0111, Rv0228, etc. Contains PS00881 Protein splicing signature.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS14016581402809+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1254|Rv1254
MTLPKERAAQGGLERIAHVDRVASLTGIRAVAALLVVGTHAAYTTGKYTHGYWGLMSSRMEIGVPIFFVLSGFLLFRPWVKSAATGGPPPSLSRYAWHRVRRIMPAYTVTVLLAYLVYHFRTAGPNPGHTWVGLFRNLTLTQIYTDGYLGAFLHQGLTQMWSLAVEVAFYLALPALAYLLLVLVCRRRWQPRLLLATMAGLTMISPAWLILVHNTHWMPDGARLWLPTYLAWFVGGMMLAVLAAMGVRCYAFVAIPLAVICYFIVSTPIAGAPTTSPTALAEALVKTAFYAVIAVLAVAPLALGDQGWYAQLLASRPMVFLGEISYEIFLIHLVTMEIAMVDVLGYRVYTSSMVNLCLVTLVLTIPLAWLLHRFTRVQGDRPS