Gene Rv1254
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Catalyzes the acylation of the mycaminose sugar during midecamycin biosynthesis |
| Product | Probable acyltransferase |
| Comments | Rv1254, (MTCY50.28c), len: 383 aa. Probable Acyltransferase, similar to G927228 midecamycin 4-0-propionyl transferase (fragment) (388 aa), FASTA scores, opt: 305, E(): 5.6e-14, (28.4% identity in 377 aa overlap). Also similar to other Mycobacterium tuberculosis acyltransferases e.g. Rv0111, Rv0228, etc. Contains PS00881 Protein splicing signature. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1401658 | 1402809 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1254|Rv1254
MTLPKERAAQGGLERIAHVDRVASLTGIRAVAALLVVGTHAAYTTGKYTHGYWGLMSSRMEIGVPIFFVLSGFLLFRPWVKSAATGGPPPSLSRYAWHRVRRIMPAYTVTVLLAYLVYHFRTAGPNPGHTWVGLFRNLTLTQIYTDGYLGAFLHQGLTQMWSLAVEVAFYLALPALAYLLLVLVCRRRWQPRLLLATMAGLTMISPAWLILVHNTHWMPDGARLWLPTYLAWFVGGMMLAVLAAMGVRCYAFVAIPLAVICYFIVSTPIAGAPTTSPTALAEALVKTAFYAVIAVLAVAPLALGDQGWYAQLLASRPMVFLGEISYEIFLIHLVTMEIAMVDVLGYRVYTSSMVNLCLVTLVLTIPLAWLLHRFTRVQGDRPS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant