Gene Rv1277
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv1277, (MTCY50.05c), len: 417 aa. Conserved hypothetical protein, some similarity to 3914967|O68033|SBCD_RHOCA exonuclease SBCD homolog from Rhodobacter capsulatus (405 aa). May be sbcD protein (see Mizrahi & Andersen 1998) |
Functional category | Conserved hypotheticals |
Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h of starvation (see Betts et al., 2002). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1426164 | 1427417 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1277|Rv1277 VSPRPGPAGRGPAPCRCADLHSLCVDSHALRRDGMRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLKALAADVGAEFVVVAGDVFEHNQLAPQIVGQSLEAMRVIGLPVYLLPGNHDPLDASSVYTSTLFRAERPDNVVVLDRAGVHEVRPGVQIVAAPWRSKAPTTDPVAEVLAGLPTDAAIRLLVAHGGVDALDPDHDKPSLIRLAALDDALTRQAIHYVALGDKHSLTQVGSSGRVWYSGAPEVTNFDDVEPDPGHVLVVDIDESDPRHPVTVDARRIGRWRFVTLHHQVDTSRDIADLDLNLDLMTDKDRTVVRLALTGSLTVTDRAALDTCLDKYARLFAWLGLWERHTDLAVIPVDAEFTDLGIGGFAAAAVDELVATARGGDDESAVDAQAALALLLRLADRGAA
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant