Gene Rv1285
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in sulfate activation pathway. First step in the sulfate activation pathway. This reaction occurs early in the reductive branch of the cysteine biosynthetic pathway [catalytic activity:ATP + sulfate = diphosphate + adenylylsulfate] |
| Product | Probable sulfate adenylyltransferase subunit 2 CysD |
| Comments | Rv1285, (MTCY373.04), len: 332 aa. Probable cysD, sulfate adenylyltransferase subunit 2 (see Wooff et al., 2002), homology suggests start site at aa 24 or 28, similar to e.g. CYSD_ECOLI|P21156 sulfate adenylate transferase subunit 2 from Escherichia coli (302 aa), FASTA score: opt: 973, E():0, (52.5% identity in 303 aa overlap). Also similar to Mycobacterium tuberculosis Rv2392, 3'-phosphoadenylylsulfate reductase. Belongs to the PAPS reductase family. CYSD subfamily. Thought to be differentially expressed within host cells (see Triccas et al., 1999). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (see Rosenkrands et al., 2000). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis: up-regulated at high temperatures (see Stewart et al., 2002), and up-regulated after 24h of starvation (see Betts et al., 2002). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1437909 | 1438907 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1285|cysD
MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRLVVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAETAVARLTERGATRADDRISEAGMEDRKRQGYF
Bibliography
- Triccas JA et al. [1999]. Use of fluorescence induction and sucrose counterselection to identify Mycobacterium tuberculosis genes expressed within host cells. Regulation
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Wooff E et al. [2002]. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Secondary Homolog Function
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
