Gene Rv1333
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown; probably involved in cellular metabolism |
Product | Probable hydrolase |
Comments | Rv1333, (MTCY130.18), len: 344 aa. Possible hydrolase, similar to Q57326|D26094 endo-type 6-aminohexanoate oligomer hydrolase (355 aa), fasta scores: E(): 1.4e-10, (31.9% identity in 339 aa overlap). Equivalent to P53425|YD33_MYCLE hypothetical 36.1 KD protein B154 Mycobacterium leprae (362 aa), FASTA scores: opt: 1735, E(): 0, (76.7% identity in 352 aa overlap). |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1501599 | 1502633 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1333|Rv1333 MNSITDVGGIRVGHYQRLDPDASLGAGWACGVTVVLPPPGTVGAVDCRGGAPGTRETDLLDPANSVRFVDALLLAGGSAYGLAAADGVMRWLEEHRRGVAMDSGVVPIVPGAVIFDLPVGGWNCRPTADFGYSACAAAGVDVAVGTVGVGVGARAGALKGGVGTASATLQSGVTVGVLAVVNAAGNVVDPATGLPWMADLVGEFALRAPPAEQIAALAQLSSPLGAFNTPFNTTIGVIACDAALSPAACRRIAIAAHDGLARTIRPAHTPLDGDTVFALATGAVAVPPEAGVPAALSPETQLVTAVGAAAADCLARAVLAGVLNAQPVAGIPTYRDMFPGAFGS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant