Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved lipoprotein LprD
CommentsRv1343c, (MTCY02B10.07c), len: 126 aa. Probable lprD, conserved lipoprotein, highly similar to G466928 Mycobacterium leprae protein B1549_F3_106 (126 aa), FASTA scores, opt: 704, E(): 7.5e-36, (78.4 % identity in 125 aa overlap). Has N-terminal signal sequence and appropriately positioned prokaryotic lipoprotein attachment site. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsDNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15085431508923-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1343c|lprD
VSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARKQNRTTA
      
Bibliography