Gene Rv1346 (fadE14)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in the biogenesis of the hydroxyphenyloxazoline-containing siderophore mycobactins |
| Product | Acyl-CoA dehydrogenase MbtN |
| Comments | Rv1346, (MTCY02B10.10), len: 386 aa. mbtN, acyl-CoA dehydrogenase, similar to many e.g. NP_251579.1|NC_002516 probable acyl-CoA dehydrogenase from Pseudomonas aeruginosa (386 aa); NP_036951.1|NM_012819|ACDL_RAT|P15650 acyl Coenzyme A dehydrogenase (long chain) from Rattus norvegicus (430 aa), FASTA scores: opt: 414, E(): 1.2e-18, (26.1% identity in 376 aa overlap); etc. Note that previously known as fadE14. |
| Functional category | Lipid metabolism |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1510846 | 1512006 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1346|mbtN
MTAGSDLDDFRGLLAKAFDERVVAWTAEAEAQERFPRQLIEHLGVCGVFDAKWATDARPDVGKLVELAFALGQLASAGIGVGVSLHDSAIAILRRFGKSDYLRDICDQAIRGAAVLCIGASEESGGSDLQIVETEIRSRDGGFEVRGVKKFVSLSPIADHIMVVARSVDHDPTSRHGNVAVVAVPAAQVSVQTPYRKVGAGPLDTAAVCIDTWVPADALVARAGTGLAAISWGLAHERMSIAGQIAASCQRAIGITLARMMSRRQFGQTLFEHQALRLRMADLQARVDLLRYALHGIAEQGRLELRTAAAVKVTAARLGEEVISECMHIFGGAGYLVDETTLGKWWRDMKLARVGGGTDEVLWELVAAGMTPDHDGYAAVVGASKA
Bibliography
- Rodriguez GM, Voskuil MI, Gold B, Schoolnik GK and Smith I [2002]. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Krithika R et al. [2006]. A genetic locus required for iron acquisition in Mycobacterium tuberculosis. Function Product
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant