Gene Rv1360
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Probable oxidoreductase |
| Comments | Rv1360, (MTCY02B10.24), len: 340 aa. Probable oxidoreductase. Similar to Q49598|G1002714 coenzyme F420-dependent n5, n10-methylenetetrahydromethanopterin reductase from Methanopyrus kandleri (349 aa), FASTA scores: opt: 264, E(): 4.4e-11, (26.3% identity in 323 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1531348 | 1532370 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1360|Rv1360
MGGARRLKLDGSIPNQLARAADAAVALERNGFDGGWTAEASHDPFLPLLLAAEHTSRLELGTNIAVAFARNPMIVANVGWDLQTYSKGRLILGLGTQIRPHIEKRFSMPWGHPARRMREFVAALRAIWLAWQDGTKLCFEGEFYTHKIMTPMFTPEPQPYPVPRVFIAAVGEAMTEMCGEVADGHLGHPMVSKRYLTEVSVPALLRGLARSGRDRSAFEVSCEVMVATGADDAELAAACTATRKQIAFYGSTPAYRKVLEQHGWGDLHPELHRLSKLGEWEAMGGLIDDEMLGAFAVVGPVDTIAGALRNRCEGVVDRVLPIFMAASQECINAALQDFRR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
