Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductProbable oxidoreductase
CommentsRv1360, (MTCY02B10.24), len: 340 aa. Probable oxidoreductase. Similar to Q49598|G1002714 coenzyme F420-dependent n5, n10-methylenetetrahydromethanopterin reductase from Methanopyrus kandleri (349 aa), FASTA scores: opt: 264, E(): 4.4e-11, (26.3% identity in 323 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15313481532370+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1360|Rv1360
MGGARRLKLDGSIPNQLARAADAAVALERNGFDGGWTAEASHDPFLPLLLAAEHTSRLELGTNIAVAFARNPMIVANVGWDLQTYSKGRLILGLGTQIRPHIEKRFSMPWGHPARRMREFVAALRAIWLAWQDGTKLCFEGEFYTHKIMTPMFTPEPQPYPVPRVFIAAVGEAMTEMCGEVADGHLGHPMVSKRYLTEVSVPALLRGLARSGRDRSAFEVSCEVMVATGADDAELAAACTATRKQIAFYGSTPAYRKVLEQHGWGDLHPELHRLSKLGEWEAMGGLIDDEMLGAFAVVGPVDTIAGALRNRCEGVVDRVLPIFMAASQECINAALQDFRR