Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in sulfation: activity towards typical ceramide glycolipids and trehalose glycolipids.
ProductGlycolipid sulfotransferase
CommentsRv1373, (MTCY02B12.07), len: 326 aa. Glycolipid sulfotransferase (see citation below); slight similarity to sulfotransferases e.g. SUOE_CAVPO|P49887 estrogen sulfotransferase from Cavia porcellus (Guinea pig) (296 aa), FASTA scores, opt: 165, E():0.00054, (24.5% identity in 294 aa overlap).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15460121546992+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1373|Rv1373
MNSEHPMTDRVVYRSLMADNLRWDALQLRDGDIIISAPSKSGLTWTQRLVSLLVFDGPDLPGPLSTVSPWLDQTIRPIEEVVATLDAQQHRRFIKTHTPLDGLVLDDRVSYICVGRDPRDAAVSMLYQSANMNEDRMRILHEAVVPFHERIAPPFAELGHARSPTEEFRDWMEGPNQPPPGIGFTHLKGIGTLANILHQLGTVWVRRHLPNVALFHYADYQADLAGELLRPARVLGIAATRDRARDLAQYATLDAMRSRASEIAPNTTDGIWHSDERFFRRGGSGDWQQFFTEAEHLRYYHRINQLAPPDLLAWAHEGRRGYDPAN