Gene Rv1482c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1482c, (MTCY277.03c), len: 280 aa. Conserved hypothetical protein, highly similar to O07396|AF002133 Mycobacterium avium protein MAV346 (346 aa), FASTA scores: E(): 0, (65.2% identity in 342 aa overlap); slight similarity to GRPE_ECOLI|P09372 heat shock protein from E. coli (197 aa), FASTA scores: opt: 139, E(): 0.012, (28.3% identity in 159 aa overlap). Similar to Mycobacterium tuberculosis hypothetical proteins Rv3517, Rv3555c, Rv3714c, Rv1073, etc. Start changed since first submission (-59 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1672457 | 1673299 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1482c|Rv1482c
MTDPFLGSEALAAGVLTPYELRSRYVALHKDVYVPQGVELTAQLRAKALWLRSRRRGVLAGYSASAFHGAKWIDADLPAAIIDTNRRRAPGLQVWEERIEPDEICVIEGMRVTTPERTALDLTSRFPLDPAVAAVDALIQATDLKVADVEPLIERYRGRRGMKAARAALDLVDGGAQSPKETWLRLLLIRAGFPRPQTQIAVRNEWGWAEAHLDMGWQDIKVAAEYDGDHHLTSRYHYRKDILRHEKVQHRYGWIVVRVVAEDHPADIIRRVGEARAFRA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
