Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1482c, (MTCY277.03c), len: 280 aa. Conserved hypothetical protein, highly similar to O07396|AF002133 Mycobacterium avium protein MAV346 (346 aa), FASTA scores: E(): 0, (65.2% identity in 342 aa overlap); slight similarity to GRPE_ECOLI|P09372 heat shock protein from E. coli (197 aa), FASTA scores: opt: 139, E(): 0.012, (28.3% identity in 159 aa overlap). Similar to Mycobacterium tuberculosis hypothetical proteins Rv3517, Rv3555c, Rv3714c, Rv1073, etc. Start changed since first submission (-59 aa).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16724571673299-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1482c|Rv1482c
MTDPFLGSEALAAGVLTPYELRSRYVALHKDVYVPQGVELTAQLRAKALWLRSRRRGVLAGYSASAFHGAKWIDADLPAAIIDTNRRRAPGLQVWEERIEPDEICVIEGMRVTTPERTALDLTSRFPLDPAVAAVDALIQATDLKVADVEPLIERYRGRRGMKAARAALDLVDGGAQSPKETWLRLLLIRAGFPRPQTQIAVRNEWGWAEAHLDMGWQDIKVAAEYDGDHHLTSRYHYRKDILRHEKVQHRYGWIVVRVVAEDHPADIIRRVGEARAFRA