Gene Rv1498c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Causes methylation |
| Product | Probable methyltransferase |
| Comments | Rv1498c, (MTCY277.20c), len: 205 aa. Probable methyltransferase. Similar to G2792343|AF040571 methyltransferase from amycolatopsis mediterranei (272 aa), FASTA scores: E(): 5.1e-11, (32.3% identity in 124 aa overlap). Contains PS00017 ATP/GTP-binding site motif A. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1689303 | 1689920 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1498c|Rv1498c
VLDVGCGSGRMALPLTGYLNSEGRYAGFDISQKAIAWCQEHITSAHPNFQFEVSDIYNSLYNPKGKYQSLDFRFPYPDASFDVVFLTSVFTHMFPPDVEHYLDEISRVLKPGGRCLCTYFLLNDESLAHIAEGKSAHNFQHEGPGYRTIHKKRPEEAIGLPETFVRDVYGKFGLAVHEPLHYGSWSGREPRLSFQDIVIATKTAS
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
