Gene Rv1510
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved probable membrane protein |
| Comments | Rv1510, (MTCY277.32), len: 432 aa. Probable membrane protein. Highly similar to Rv3630|MTCY15C10.22 (431 aa), FASTA scores: E(): 0, (70.8% identity in 424 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1701295 | 1702593 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1510|Rv1510
MYERRHERGMCDRAVEMTDVGATAAPTGPIARGSVARVGAATALAVACVYTVIYLAARDLPPACFSIFAVFWGALGIATGATHGLLQETTREVRWVRSTQIVAGHRTHPLRVAGMIGTVAAVVIAGSSPLWSRQLFVEGRWLSVGLLSVGVAGFCAQATLLGALAGVDRWTQYGSLMVTDAVIRLAVAAAAVVIGWGLAGYLWAATAGAVAWLLMLMASPTARSAASLLTPGGIATFVRGAAHSITAAGASAILVMGFPVLLKVTSDQLGAKGGAVILAVTLTRAPLLVPLSAMQGNLIAHFVDRRTQRLRALIAPALVVGGIGAVGMLAAGLTGPWLLRVGFGPDYQTGGALLAWLTAAAVAIAMLTLTGAAAVAAALHRAYLLGWVSATVASTLLLLLPMPLETRTVIALLFGPTVGIAIHVAALARRPD
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
