Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv1514c, (MTCY277.36c), len: 262 aa. Conserved hypothetical protein. Similar to other hypothetical proteins, and to WCAE_ECOLI|P71239 putative colanic acid biosynthesis glycosyl transferase (248 aa), FASTA scores: opt: 231, E(): 4.1e-08, (33.3% identity in 210 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical glycosyltransferase, Rv2957.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17058071706595-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1514c|Rv1514c
VTSAPTVSVITISFNDLDGLQRTVKSVRAQRYRGRIEHIVIDGGSGDDVVAYLSGCEPGFAYWQSEPDGGRYDAMNQGIAHASGDLLWFLHSADRFSGPDVVAQAVEALSGKGPVSELWGFGMDRLVGLDRVRGPIPFSLRKFLAGKQVVPHQASFFGSSLVAKIGGYDLDFGIAADQEFILRAALVCEPVTIRCVLCEFDTTGVGSHREPSAVFGDLRRMGDLHRRYPFGGRRISHAYLRGREFYAYNSRFWENVFTRMSK