Gene Rv1515c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1515c, (MTCY277.37c), len: 298 aa. Conserved hypothetical protein, similar to P71805|MTCY02B12.11C|Rv1377c Hypothetical protein from Mycobacterium tuberculosis, FASTA scores: E(): 1.3e-05, (25.4% identity in 134 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1706630 | 1707526 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1515c|Rv1515c
MSTNPGPAEGANQVMAQEHSAGAVQFTAHNVRLDDGTLTIPESSRTLDESSWFISARGILETVFPGDKSHLRLADVGCLEGGYAVGFARMGFQVLGIEVRELNMAACNYIKSKTNLPNLRFVHDNALNIANHGLFDTVFCCGLFYHLENPKQYLETLSSVTNKLLILQTHFSIINRSDKWLRLPTTARQLTDRLLRRPAPVKFMLSAPTEHEGLPGRWFTEFSDDRSFGQRDTAKWASWDNRRSFWIQREHLLQAIKDVGVDLVMEEYDNLEPSIAESLLGGSYAANLRGTFIGIKTR
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
