Gene Rv1516c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; involved in cellular metabolism. |
| Product | Probable sugar transferase |
| Comments | Rv1516c, (MTCY277.38c), len: 336 aa. Probable sugar transferase, similar to AB010970|AB010970_6 glycosyltransferase from Streptococcus mutans (465 aa), FASTA scores: opt: 388, E(): 4.1e-18, (32.7% identity in 214 aa overlap), slight similarity to SPSA_BACSU|P39621 spore coat polysaccharide biosynthesis (256 aa), fasta scores: opt: 185, E(): 6.5e-05, (26.2% identity in 187 aa overlap), strong similarity to Rv1520|MTCY19G5.08c probable sugar transferase from Mycobacterium tuberculosis (63.5% identity in 318 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1707529 | 1708539 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1516c|Rv1516c
VSPQLCPKVSIVSTTHNQAGYARQAFDSFLDQQTDFPVEIIVADDASTDATPAIIREYAERYPHVFRPIFRTENLGLNGNLTGALSAARGEYVALCEADDYWIDPLKLSKQVAFLDRHPKTTVCFHPVRVIWEDGHAKDSKFPPVRVRGNLSLDALILMNFIQTNSAVYRRLERYDDIPADVMPLDWYLHVRHAVHGDIAMLPDTMAVYRRHAQGMWHNQVVDPPKFWLTQGPGHAATFDAMLDLFPGDPAREELIAVMADWILRQIANVPGPEGRAALQETIARHPRIAMLALQHRGATPARRLKTQWRKLAAATPSRRGLVDVWPSRLRRGCRA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
