Gene Rv1562c (glgZ)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in trehalose biosynthesis (protective effect). Mycobacteria can produce trehalose from glucose 6-phosphate and UDP-glucose (the OTSA-OTSB pathway) from glycogen-like alpha(1-->4)-linked glucose polymers (the trey-TREZ pathway) and from maltose (the TRES pathway). Seems to have additional alpha-glucosidase activity. |
| Product | Maltooligosyltrehalose trehalohydrolase TreZ |
| Comments | Rv1562c, (MTCY48.03), len: 580 aa. TreZ (previously called glgZ), Maltooligosyltrehalose trehalohydrolase, confirmed biochemically (see citation below). Similar to Q44316|D63343 TREZ maltooligosyl trehalose trehalohydrolase from arthrobacter SP (598 aa), FASTA scores: opt: 2071, E(): 0, (52.2% identity in 582 aa overlap); also similar to 1,4-alpha-glucan branching enzymes e.g. GLGB_BACST|P30538 (639 aa), FASTA scores: opt: 313, E(): 3.8e-13, (27.5% identity in 462 aa overlap). Also similar to Mycobacterium tuberculosis proteins Rv1326c|glgB, and Rv1563c treY (previously glgY). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Mutation of treZ|Rv1562c in M. tuberculosis H37Rv has no effect on glucan or glycogen content; growth in BALB/c mice is comparable to wild-type (See Sambou et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1765400 | 1767142 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1562c|treZ
MPEFRVWAPKPALVRLDVNGAVHAMTRSADGWWHTTVAAPADARYGYLLDDDPTVLPDPRSARQPDGVHARSQRWEPPGQFGAARTDTGWPGRSVEGAVIYELHIGTFTTAGTFDAAIEKLDYLVDLGIDFVELMPVNSFAGTRGWGYDGVLWYSVHEPYGGPDGLVRFIDACHARRLGVLIDAVFNHLGPSGNYLPRFGPYLSSASNPWGDGINIAGADSDEVRHYIIDCALRWMRDFHADGLRLDAVHALVDTTAVHVLEELANATRWLSGQLGRPLSLIAETDRNDPRLITRPSHGGYGITAQWNDDIHHAIHTAVSGERQGYYADFGSLATLAYTLRNGYFHAGTYSSFRRRRHGRALDTSAIPATRLLAYTCTHDQVGNRALGDRPSQYLTGGQLAIKAALTLGSPYTAMLFMGEEWGASSPFQFFCSHPEPELAHSTVAGRKEEFAEHGWAADDIPDPQDPQTFQRCKLNWAEAGSGEHARLHRFYRDLIALRHNEADLADPWLDHLMVDYDEQQRWVVMRRGQLMIACNLGAEPTCVPVSGELVLAWESPIIGDNSTELAAYSLAILRAAEPA
Bibliography
- De Smet KA et al. [2000]. Three pathways for trehalose biosynthesis in mycobacteria. Function Product Biochemistry
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sambou T et al. [2008]. Capsular glucan and intracellular glycogen of Mycobacterium tuberculosis: biosynthesis and impact on the persistence in mice. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
