Gene Rv1572c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1572c, (MTCY336.31B), len: 34 aa. Partial ORF, part of REP13E12 repeat element; 3' end of Rv1587c (MTCY336.17) after phage-like element (see citation below). Similar to C-terminal ends of other REP13E12 repeat elements e.g. Rv1148, Rv1945, Rv3467, etc. Length extended since first submission (+7 aa). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Mutant | Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1779194 | 1779298 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1572c|Rv1572c
VECSSAVHGQPRTNTFHHHEKLLRHNDEDNHDDP
Bibliography
- Gordon SV et al. [1999]. New insertion sequences and a novel repeated sequence in the genome of Mycobacterium tuberculosis H37Rv. Sequence
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
