Gene Rv1674c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Probable transcriptional regulatory protein |
| Comments | Rv1674c, (MTV047.09c), len: 218 aa. Probable transcriptional regulatory protein. Highly similar to AJ005575|SPE005575_2 Streptomyces peucetius (226 aa), FASTA scores: opt: 662, E(): 0, (50.0% identity in 208 aa overlap). Similar to Rv0324|Z96800|MTCY63.29 M. tuberculosis cosmid (226 aa), FASTA scores: opt: 579, E(): 0, (45.3% identity in 214 aa overlap). N-terminus is similar to transcriptional activators e.g. MERR_STRLI|P30346 probable mercury resistance operon regulator (125 aa), FASTA scores: opt: 183, E(): 1.9e-06, (35.6% identity in 90 aa overlap). Contains PS00380 Rhodanese signature 1. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1899260 | 1899916 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1674c|Rv1674c
MSGAKKLIFEQFALVGQALSSGHRLELLDLLVQGERSVDALARASGLTFANASQHLLQLRRAGLVTSRRDGKRVIYALSDPQVWDVVRAVRAVAERNLASVGSLVRQYYTDRDSLEPISRDELQARVAAGSVLVLDVRPAMEYAAGHLPGAVSIPLDELAERLDELPSGIDIVACCRGPYCVYAYDALELLRPNGFSARRLDGGFSEWLAADLPVVRT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
