Gene Rv1700
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | NUDIX hydrolases catalyze the hydrolysis of a variety of nucleoside diphoshate derivatives |
| Product | NUDIX hydrolase |
| Comments | Rv1700, (MTCI125.22), len: 207 aa. Nudix hydrolase, equivalent to Q49891|MLC1351.08C|Z95117 Hypothetical protein from Mycobacterium leprae (177 aa), FASTA scores: (66.7% identity in 171 aa overlap); also similar to Q9S225|SCI51.15C|AL109848 Hypothetical protein from Streptomyces coelicolor (211 aa), FASTA scores: opt: 508, E(): 1.2e-27, (43.1% identity in 197 aa overlap); similar to P54570|ADPP_BACSU ADP-ribose pyrophosphatase (185 aa), FASTA scores: opt: 313, E(): 1.1e-06, (42.7% identity in 124 aa overlap). Belongs to the family of Nudix hydrolases |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1925582 | 1926205 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1700|Rv1700
VAEHDFETISSETLHTGAIFALRRDQVRMPGGGIVTREVVEHFGAVAIVAMDDNGNIPMVYQYRHTYGRRLWELPAGLLDVAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDESVRVYLATGLREVGRPEAHHEEADMTMGWYPIAEAARRVLRGEIVNSIAIAGVLAVHAVTTGFAQPRPLDTEWIDRPTAFAARRAER
Bibliography
- Kang LW et al. [2003]. Structure and mechanism of MT-ADPRase, a nudix hydrolase from Mycobacterium tuberculosis. Product Structure
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
