Gene Rv1723
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism |
| Product | Probable hydrolase |
| Comments | Rv1723, (MTCY04C12.08), len: 415 aa. Possible hydrolase, similar to others e.g. NYLB_FLASP|P07061 6-aminohexanoate-dimer hydrolase from Flavobacterium sp. (392 aa), FASTA scores: opt: 717, E(): 0, (35.1% identity in 396 aa overlap). Also similar to M. tuberculosis hypothetical esterases and penicillin binding proteins e.g. Rv1923, Rv1497, Rv2463, etc |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1949342 | 1950589 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1723|Rv1723
VSGGVPAGLALDNWLSSPYSHWAFQHVEDFMPTTVIARGTEPVVTLPADNAPIADIGLTSTDGIATTVGAVMAATATDGWAVAHRGALVAEQYLDGLGPRTRHLLFSVSKSLVAAVVGALHGAGAIELDAPVTAYVPALADCGYAGATVRHLLDMRSGVAFSENYDDPAAEIHVREQVIGWAPKRGPDLPATLRDYLLTLRRKSAHGGPFEYRSCETDVLGWICEAAAGQPMPELMSELLWSRIGAQCDATIALDVAGAAGTGIFDGGISACLTDMIRFGSLYLRDGVSLAGQQVVPAAWIADTFDGGPDSRQAFAASPDDNPMPGGMYRNQVWFPYPGSNVALCVGMCGQLIYVNRAAEVVAAKLSTQPHSHEPHMLDTLRAFDAVAHELSGIRSSSTNDPQRPSPPAQEASPG
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
