Gene Rv1728c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1728c, (MTCY04C12.13c), len: 256 aa. Conserved hypothetical protein, some similarity to O07246|Rv0320|MTCY63.25 possible exported protein from Mycobacterium tuberculosis (220 aa), FASTA scores: E(): 1.3e-31, (42.3% identity in 220 aa overlap). C-terminal region similar to Q9ZX60|AF068845|AF068845_17 segment of gp17 of Mycobacteriophage TM4 (1229 aa), FASTA scores: opt: 385, E(): 4.3e-17, (44.6% identity in 139 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1953864 | 1954634 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1728c|Rv1728c
MSVNGLPGAHNAGLQPIDSKGCHTRRTRHTKVLFVSKGVLANGRGRWLAIAASLVVSAAILYAQGAEHTCCRETPAAIPTGPDSAPANAPRIASPTEADLLAASAPVAAQQFQFALPAGVASEEGLQVKTIWVARAVSVLFPQITNIFGYRQDPLKWHPNGLAIDVMIPNHHSDEGIQLGNQVAGLALANAKRWGVLHVIWRQGYYPGIGAPSWTADYGSETLNHYDHVHIATDGGGYPTGRETYYVGSMSPTPPE
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
