Gene Rv1755c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolyzes sphingomyelin in addition to phosphatidylcholine. Probable virulence factor implicated in the pathogenesis of M.tuberculosis at the level of intracellular survival, by the alteration of cell signaling events or by direct cytotoxicity [catalytic activity: a phosphatidylcholine + H(2)O = 1,2- diacylglycerol + choline phosphate]. |
| Product | Probable phospholipase C 4 (fragment) PlcD |
| Comments | Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below), highly similar to C-terminus of other phospholipases e.g. CQ50771|Rv2351c|PLCA|MTP40|MT2416|MTCY98.20c phospholipase C 1 from Mycobacterium tuberculosis (512 aa), FASTA score: (71.1% identity in 284 aa overlap); etc. Note that this ORF has been interrupted by insertion of IS6110 element. Belongs to the bacterial phospholipase C family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1986854 | 1987696 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1755c|plcD
DAGVSWKVYRNKTLGPISSVLTYGSLVTSFKQSADPRSDLVRFGVAPSYPASFAADVLANRLPRVSWVIPNVLESEHPAVPAAAGAFAIVNILRILLANPAVWEKTALIVSYDENGGFFDHVVPATAPAGTPGEYVTVPDIDQVPGSGGIRGPIGLGFRVPCFVISPYSRGPQMVHDTFDHTSQLRLLETRFGVPVPNLTAWRRSVTGDMTSTFNFAVPPNSSWPNLDYPGLHALSTVPQCVPNAALGTINRGIPYRVPDPQIMPTQETTPTRGIPSGPC
Bibliography
- Gordon SV et al. [1999]. Identification of variable regions in the genomes of tubercle bacilli using bacterial artificial chromosome arrays. Secondary Sequence
- Stonehouse MJ et al. [2002]. A novel class of microbial phosphocholine-specific phospholipases C. Homolog Product Biochemistry
- Raynaud C, Guilhot C, Rauzier J, Bordat Y, Pelicic V, Manganelli R, Smith I, Gicquel B and Jackson M [2002]. Phospholipases C are involved in the virulence of Mycobacterium tuberculosis. Mutant Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
