Gene Rv1758 (culp5, clp5)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolysis of cutin. |
| Product | Probable cutinase Cut1 |
| Comments | Rv1758, (MTCY28.24), len: 174 aa. Probable cut1, serine esterase, cutinase family, similar to Rv2301|CUT2_MYCTU|Q50664 probable cutinase cy339.08c precursor from Mycobacterium tuberculosis (219 aa), FASTA scores: opt: 369, E(): 1. 1e-16, (39.1% identity in 179 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical cutinases Rv3452, Rv1984c, Rv3451 and Rv3724. CDS has been interrupted by IS6110 insertion element and 5'-end deleted. Belongs to the cutinase family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1989042 | 1989566 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1758|cut1
MPGRFREDFIDALRSKIGEKSMGVYGVDYPATTDFPTAMAGIYDAGTHVEQTAANCPQSKLVLGGFSQGAAVMGFVTAAAIPDGAPLDAPRPMPPEVADHVAAVTLFGMPSVAFMHSIGAPPIVIGPLYAEKTIQLCAPGDPVCSSGGNWAAHNGYADDGMVEQAAVFAAGRLG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- West NP, Chow FM, Randall EJ, Wu J, Chen J, Ribeiro JM and Britton WJ [2009]. Cutinase-like proteins of Mycobacterium tuberculosis: characterization of their variable enzymatic functions and active site identification. Function
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
