Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHydrolysis of cutin.
ProductProbable cutinase Cut1
CommentsRv1758, (MTCY28.24), len: 174 aa. Probable cut1, serine esterase, cutinase family, similar to Rv2301|CUT2_MYCTU|Q50664 probable cutinase cy339.08c precursor from Mycobacterium tuberculosis (219 aa), FASTA scores: opt: 369, E(): 1. 1e-16, (39.1% identity in 179 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical cutinases Rv3452, Rv1984c, Rv3451 and Rv3724. CDS has been interrupted by IS6110 insertion element and 5'-end deleted. Belongs to the cutinase family.
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS19890421989566+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1758|cut1
MPGRFREDFIDALRSKIGEKSMGVYGVDYPATTDFPTAMAGIYDAGTHVEQTAANCPQSKLVLGGFSQGAAVMGFVTAAAIPDGAPLDAPRPMPPEVADHVAAVTLFGMPSVAFMHSIGAPPIVIGPLYAEKTIQLCAPGDPVCSSGGNWAAHNGYADDGMVEQAAVFAAGRLG