Gene Rv1765A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of an insertion element. |
| Product | Putative transposase (fragment) |
| Comments | Rv1765A, len: 71 aa. Putative transposase (fragment), similar to part of many transposase genes including IS6110 e.g. P19774|TRA9_MYCTU putative transposase from Mycobacterium tuberculosis (278 aa), FASTA scores: opt: 231, E(): 4.7e-11, (45.35% identity in 75 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1999142 | 1999357 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1765A|Rv1765A
LWVADITFVRTWQGFCYTAFVTDVCTRKIVVWAVSATMRTEDLPVQVFNHAVWQSNSDLSELVHHSDPGSQ
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
