Gene Rv1774
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism |
| Product | Probable oxidoreductase |
| Comments | Rv1774, (MTCY25C11.01), len: 446 aa. Probable oxidoreductase, similar to several e.g. HDNO_ARTOX|P08159 6-hydroxy-d-nicotine oxidase (458 aa), FASTA scores: opt: 417, E(): 6e-20, (28.4% identity in 462 aa overlap). Also some similarity to Mycobacterium tuberculosis oxidoreductase MTCY04C12.11 (24.1% identity in 444 aa overlap). Contains PS00862 Oxygen oxidoreductases covalent FAD-binding site. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2007832 | 2009172 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1774|Rv1774
MRALPAGRHFFRGSDGYEAARRGTVWHRRVPDRYPEVIVQAVSADDIVSAIRYATVNGHKVSVVSGGHSFAASHLRDGAVLLDVSRIDHASIDADKGRAVVGPGKGGSVLMAELEAQGLFFPGGHCRGVCLGGYLLQGGYGWNSRIYGPACESVIGLDVITADGAQIHCDADNHADLYWAARGAGPGFFGVVTSFYLKLYPRPATCGTSVYVYPFDLADEVFTWARAVSAEVDPRVELQALASRGEPSMGIDVPVISLASPAFADSPEEAEQALALFGTCPVVEQALVKVPYMPTDLPAWYDVAMTHYLSDHHYAVDNMWTSASAEDLLPGIRSILDTLPPHPAHFLWLNWGPCPPRQDMAYSIEADIYLALYGSWKDPADEAKYADWARSHMAAMSHLAVGIQLADENLGARPARFASDAAMAKLDRVRAEYDPDGLFNSWMGRI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
