Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism
ProductProbable oxidoreductase
CommentsRv1774, (MTCY25C11.01), len: 446 aa. Probable oxidoreductase, similar to several e.g. HDNO_ARTOX|P08159 6-hydroxy-d-nicotine oxidase (458 aa), FASTA scores: opt: 417, E(): 6e-20, (28.4% identity in 462 aa overlap). Also some similarity to Mycobacterium tuberculosis oxidoreductase MTCY04C12.11 (24.1% identity in 444 aa overlap). Contains PS00862 Oxygen oxidoreductases covalent FAD-binding site.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20078322009172+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1774|Rv1774
MRALPAGRHFFRGSDGYEAARRGTVWHRRVPDRYPEVIVQAVSADDIVSAIRYATVNGHKVSVVSGGHSFAASHLRDGAVLLDVSRIDHASIDADKGRAVVGPGKGGSVLMAELEAQGLFFPGGHCRGVCLGGYLLQGGYGWNSRIYGPACESVIGLDVITADGAQIHCDADNHADLYWAARGAGPGFFGVVTSFYLKLYPRPATCGTSVYVYPFDLADEVFTWARAVSAEVDPRVELQALASRGEPSMGIDVPVISLASPAFADSPEEAEQALALFGTCPVVEQALVKVPYMPTDLPAWYDVAMTHYLSDHHYAVDNMWTSASAEDLLPGIRSILDTLPPHPAHFLWLNWGPCPPRQDMAYSIEADIYLALYGSWKDPADEAKYADWARSHMAAMSHLAVGIQLADENLGARPARFASDAAMAKLDRVRAEYDPDGLFNSWMGRI