Gene Rv1835c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1835c, (MTCY1A11.08), len: 628 aa. Conserved hypothetical protein, some similarity to putative acylases e.g. G216374 glutaryl 7-aca acylase precursor (634 aa) FASTA scores, opt: 202, E(): 3.5e-06, (25.1% identity in 669 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical proteins Rv2800 and Rv1215c. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2080701 | 2082587 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1835c|Rv1835c
MTRRGGSDAAWYSAPDQRSAYPRYRGMRYSSCYVTMRDGVRIAIDLYLPAGLTSAARLPAILHQTRYYRSLQLRWPLRMLLGGKPLQHIAADKRRRRRFVASGYAWVDVDVRGSGASFGARVCEWSSDEIRDGAEIVDWIVRQPWCNGTVAALGNSYDGTSAELLLVNQHPAVRVIAPCFSLFDVYTDIAFPGGIHAAWFTDTWGRYNEALDRNALHEVVGWWAKLPVTGMQPVQEDRDRSLRDGAIAAHRGNYDVHQIAGSLTFRDDVSASDPYRGQPDARLEPIGTPIESGSINLISPHNYWRDVQASGAAIYSYSGWFDGGYAHAAIKRFLTVSTPGSHLILGPWNHTGGWRVDPLRGLSRPDFDHDGELLRFIDHHVKGADTGIGSEPPVHYFTMVENRWKSADTWPPPATTQSYYLSADRQLRPDAPDCDSGADEYVVDQTAGTGERSRWRSQVGIGGHVCYPDRKAQDAKLLTYTSAPLDHPLEVTGHVVVTLFITSTSSDGTFFVYLEDVDPRGRVAYITEGQLRAIHRRLSDGPPPYRQVVPYRTFASGDAWPLVPGEIARLTFDLLPTSYLFQPGHRIRIAIAGADASHFAILPGCAPTVRVYRSRMHASRIDLPVIQP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
