Gene Rv1842c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical membrane protein |
| Comments | Rv1842c, (MTCY359.31), len: 455 aa. Conserved hypothetical membrane protein. Similar to Z99109|0O7589 Potential integral membrane protein from Bacillus subtilis (461 aa), FASTA scores: opt: 723, E(): 0, (31.2% identity in 449 aa overlap). Similar to other Mycobacterium tuberculosis putative integral membrane proteins e.g. Rv2366c, Rv1841c. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2090718 | 2092085 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1842c|Rv1842c
VNLTDTVATILAILALTAGTGVFVAAEFSLTALDRSTVEANARGGTSRDRFIQRAHHRLSFQLSGAQLGISITTLATGYLTEPLVAELPHPGLVAVGMSDRVADGLITFFALVIVTSLSMVFGELVPKYLAVARPLRTARSVVAGQVLFSLLLTPAIRLTNGAANWIVRRLGIEPAEELRSARTPQELVSLVRSSARSGALDDATAWLMRRSLQFGALTAEELMTPRSKIVALQTDDTIADLVAAAAASGFSRFPVVEGDLDATVGIVHVKQVFEVPPGDRAHTLLTTVAEPVAVVPSTLDGDAVMAQVRASALQTAMVVDEYGGTAGMVTLEDLIEEIVGDVRDEHDDATPDVVAAGNGWRVSGLLRIDEVASATGYRAPDGPYETIGGLVLRELGHIPVAGETVELTALDQDGLPDDSMRWLATVIQMDGRRIDLLELIKMGGHADPGSGRGR
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
