Gene Rv1851
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Probably facilitates nickel incorporation |
| Product | Urease accessory protein UreF |
| Comments | Rv1851, (MTCY359.22c), len: 211 aa. UreF, urease accessory protein. Identical to UREF_MYCTU|P50050 from M. tuberculosis. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2099694 | 2100329 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1851|ureF
MTSLAVLLTLADSRLPTGAHVHSGGIEEAIAAGMVTGLATLEAFLKRRVRTHGLLTASIAAAVHRGELAVDDADRETDARTPAPAARHASRSQGRGLIRLARRVWPDSGWEELGPRPHLAVVAGRVGALSGLAPEHNALHLVYITMTGSAIAAQRLLALDPAEVTVVTFQLSELCEQIAQEATAGLADLSDPLLDTLAQRHDERVRPLFVS
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
