Gene Rv1857
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the active transport of molybdenum into the cell across the membrane (import). Part of the binding-protein-dependent transport system modabc. |
| Product | Probable molybdate-binding lipoprotein ModA |
| Comments | Rv1857, (MTCY359.16c), len: 261 aa. Probable modA, molybdate-binding protein attached to membrane by lipid-modified N-terminal cysteine (contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site), component of molybdate transport system (see citations below). Shows strong similarity to precursors of periplasmic molybdate/sulphate binding proteins e.g. O31229|Y10817|ANY108174 ModA from Arthrobacter nicotinovorans (260 aa), FASTA score: opt: 725, E(): 0, (47.8% identity in 249 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2104985 | 2105770 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1857|modA
VRWIGLSTGLVSAMLVAGLVACGSNSPASSPAGPTQGARSIVVFAAASLQSAFTQIGEQFKAGNPGVNVNFAFAGSSELATQLTQGATADVFASADTAQMDSVAKAGLLAGHPTNFATNTMVIVAAAGNPKKIRSFADLTRPGLNVVVCQPSVPCGSATRRIEDATGIHLNPVSEELSVTDVLNKVITGQADAGLVYVSDALSVATKVTCVRFPEAAGVVNVYAIAVLKRTSQPALARQFVAMVTAAAGRRILDQSGFAKP
Bibliography
- Camacho LR, Ensergueix D, Perez E, Gicquel B and Guilhot C [1999]. Identification of a virulence gene cluster of Mycobacterium tuberculosis by signature-tagged transposon mutagenesis. Mutant
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
