Gene Rv1888A
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv1888A, len: 57 aa. Conserved hypothetical protein. Possibly continuation of Rv1889c, part of large family of Mycobacterium tuberculosis proteins with conserved N-terminal domain of ~ 120 aa. Includes: C-terminus of Rv0726c|P95074 conserved hypothetical protein (367 aa), FASTA scores: opt: 295, E(): 3.1e-15, (73.684% identity in 57 aa overlap); C-terminus of Rv3399|Q50726|MTCY78.29c conserved hypothetical protein (348 aa), FASTA scores: opt: 504, E(): 7.3e-29, (64.2% identity in 120 aa overlap); C-terminus of Rv0731c; etc. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2138444 | 2138617 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1888A|Rv1888A VVPVDLRRDWPTPLRQAGFDPNQPSAWLAEGLLAFLPPDAQDRLLDNITALSAPGSR
Bibliography
No article yet recorded