Gene Rv1889c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1889c, (MTCY180.29), len: 118 aa. Conserved hypothetical protein. Part of large family of Mycobacterium tuberculosis proteins with conserved N-terminal domain of ~120 aa. Includes: Rv3399|Q50726|MTCY78.29C conserved hypothetical protein (348 aa), FASTA results: opt: 504, E(): 7.3e-29, (64.2% identity in 120 aa overlap); Rv0726c|P95074; Rv0731c; etc. Rv1888A possibly continuation of this CDS. |
| Functional category | Conserved hypotheticals |
| Operon | Rv1890c and Rv1889c are co-transcribed, by RT-PCR (See Arnvig and Young, 2009). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2138661 | 2139017 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1889c|Rv1889c
MPRTNNDAWDLATSVGATATMVAAARAVATRADNPLIDDPFAEPLVRAVGIDFFTRWAAGNIKATDVDDPDGTWGLQRLADLLAARTRYFDAFFRDATSAGIRQAVILASGLDARAYR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arnvig KB et al. [2009]. Identification of small RNAs in Mycobacterium tuberculosis. Operon
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
