Gene Rv1898
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1898, (MTCY180.20c), len: 102 aa. Conserved hypothetical protein, some similarity to other hypothetical proteins e.g. Q58452 from methanococcus jannasch II (100 aa), FASTA results: opt: 152, E(): 9.1e-05, (31.5% identity in 92 aa overlap); and AE000771|AE000771_2 from Aquifex aeolicus (157 aa), FASTA results: opt: 246, E(): 3.2e-11, (39.0% identity in 100 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2144940 | 2145248 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1898|Rv1898
VSVLVAFSVTPLGVGEGVGEIVTEAIRVVRDSGLPNQTDAMFTVIEGDTWAEVMAVVQRAVEAVAARAPRVSAVIKVDWRPGVTDAMTQKVATVERYLLRPE
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
